PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC18209_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 412aa    MW: 43516.9 Da    PI: 9.1573
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC18209_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.9e-3892151362
       zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  e+alkcprCdstntkfCy+nnysl+qPr+fCkaCrryWt+GGalr vPvGgg+r+nk+++
  RrC18209_p1  92 ETALKCPRCDSTNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRTK 151
                  6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3679149IPR003851Zinc finger, Dof-type
PfamPF027014.2E-3294149IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.39495149IPR003851Zinc finger, Dof-type
PROSITE patternPS01361097133IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MVFSSFPTYP DSSNWQQQHQ PITSTVGFTG DNNISQQFLP HHPLPPQPQQ TPPPLHLSGN  60
GGGGGGPGGP GGSIRPGSMA ERARIANIPM PETALKCPRC DSTNTKFCYF NNYSLTQPRH  120
FCKACRRYWT RGGALRSVPV GGGCRRNKRT KNSSGGGGSS SSGNSKSQDS TTSNDQYHHR  180
AMGNNQMGPP PSSTSLSSLL SSYNAGLIPG HDHNMSSNNH VLGLGSSLPP LKLMPPLDFT  240
DNFTLQYGTV SAPSYHVGGG SSGGGGAASL LTGFDQWRFP APHHQLPLLG GLDSSSSSSG  300
LYPFDHQNQT GLEPQNPGYG LVTGSGQYRP KNIFHNLVSS SVSSAMVTAT ASQLASVKME  360
DSNNQLNMSR QLFGTEQQLW NIHGTAASTA AATTSSWSDV SNNFSSSSTS NI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410230.0AC241023.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039N20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125451.11e-180PREDICTED: dof zinc finger protein DOF5.1-like
SwissprotQ9LZ561e-165DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLA0A078J0Z80.0A0A078J0Z8_BRANA; BnaA03g54830D protein
STRINGBra028872.1-P1e-179(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115191732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.11e-135Dof family protein